Protein Info for GFF4051 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 51 to 77 (27 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 141 to 169 (29 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details amino acids 436 to 459 (24 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF4051 hypothetical protein (Sphingobium sp. HT1-2)
VGVCLLLFLAFFLLRFPGEPNSDSNSQYHQIVTGRFNDWHPPLMARIWEALTLFGAGTGP
IFAFDTIFYGCGVALLASLPARRGRWLCAYCMIFLAAQPMLLMMSVNIAKDIMMAVMLLL
AVAIIGAMQEGLVAARPARTLCWMLALLIVVMAALVRSNAVFLVAPMLVFAGRPALMARP
VLMLALSAVGGVLLVPASNIVNHRILGASDAGAIRSLQIFDIAGIMVRGGDDILADLPGA
QALTQDVHRCYSPIMWDTLAYAHWNCHVLKNVEQAIRDGGGASLSSRWTGAIRRHPLAYL
RHRLTHYNSTLYFWVPVHHTEAVRKLNTAGNRGGSFKNRLLDQVRYSPLTSPVMMVAIAL
ALLPWIIAALRVSRDALLRVCAILIWLALIYTGTFLLVGVATDQRYFFFTTLAVCLALPL
ALSDATIRAMMRRHSALAVATVGVPAAILALTVVARYMLPPPV