Protein Info for GFF405 in Variovorax sp. SCN45

Annotation: 3-hydroxybutyrate dehydrogenase (EC 1.1.1.30)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 5 to 256 (252 residues), 362.5 bits, see alignment E=5.3e-113 PF00106: adh_short" amino acids 5 to 195 (191 residues), 200.5 bits, see alignment E=3.9e-63 PF08659: KR" amino acids 6 to 158 (153 residues), 48.1 bits, see alignment E=2.6e-16 PF01370: Epimerase" amino acids 7 to 119 (113 residues), 22.2 bits, see alignment E=1.7e-08 PF13561: adh_short_C2" amino acids 13 to 254 (242 residues), 181.6 bits, see alignment E=3.9e-57

Best Hits

Swiss-Prot: 73% identical to BDHA_CUPNH: D-beta-hydroxybutyrate dehydrogenase (hbdH1) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 93% identity to vpe:Varpa_3338)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF405 3-hydroxybutyrate dehydrogenase (EC 1.1.1.30) (Variovorax sp. SCN45)
MLKGKTALVTGSTSGIGLAIAKSLAQQGANIVLNGFGDAEAPKSQIEALGVRAEYHGADM
SKPEQIEDMMKFAASKFGRVDILVNNAGIQHVAKVEDFPAERWDAIIAINLTSAFHTTRL
AIPAMREANWGRVINIASAHGLVASAQKSAYVAAKHGIVGLTKSVALETATTGVTVNAIC
PGWVLTALVQKQIDDRAAREGITAAQAQNELLGEKQPSLQFTTVEQLGGLAVFLCSPAAD
QVRGVAWAMDGGWTAQ