Protein Info for PS417_20730 in Pseudomonas simiae WCS417

Annotation: cytochrome oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details PF05545: FixQ" amino acids 9 to 45 (37 residues), 31.4 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: K00407, cb-type cytochrome c oxidase subunit IV [EC: 1.9.3.1] (inferred from 97% identity to pfl:PFL_1919)

MetaCyc: 75% identical to cbb3-2 cytochrome c oxidase subunit Q (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoQ (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFS0 at UniProt or InterPro

Protein Sequence (61 amino acids)

>PS417_20730 cytochrome oxidase (Pseudomonas simiae WCS417)
MDIGMIRGLGTVVVMVAFIGLALWVFSPKRKSEFEDATLLPFADDPEAIKHVEQASRSNK
E