Protein Info for GFF4042 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 367 (332 residues), 111.5 bits, see alignment E=2.2e-36

Best Hits

KEGG orthology group: None (inferred from 68% identity to npp:PP1Y_Mpl8822)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>GFF4042 hypothetical protein (Xanthobacter sp. DMC5)
MIFKQTSTLRPGAPALADAAPAPGTLGFGATLAMATAAGLAVANIYYNQPMLALMEQDLP
GALTGAIPTATQLGYAIGLVLLVPLGDLVERRRLIVVQFVLLAAALVLAAVAPTALLLVA
ASLAVGLASTVAQQIVPLAAHFAAPEKRGATVGTVMAGLLTGILLSRTVAGFVASHGGWR
EMLWLAAPMALGGAVLMAVTLPSSKPDSRLSYHRLLHSVWQQWLDFPALRLAAITQAALF
AAFTVFWTILAFRLAEPRFGLGAEVAGLFGLVGAVGILAAPLAGRFADKRGPRLAVMVGS
IVTLAAWVVFGAWGSLVGLIVGVMLLDFGMQSALVSNQHIVFALRPEARARINTVLMSAM
FLGGSIGSATATLAWGAGGWFLVTVLGTAFAAFAVGLQLLAARSRRADPSH