Protein Info for GFF4041 in Sphingobium sp. HT1-2

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 3 to 253 (251 residues), 231 bits, see alignment E=9.9e-73 PF01113: DapB_N" amino acids 3 to 112 (110 residues), 91.9 bits, see alignment E=3.4e-30 PF05173: DapB_C" amino acids 116 to 252 (137 residues), 145.1 bits, see alignment E=1e-46

Best Hits

Swiss-Prot: 67% identical to DAPB_ZYMMO: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 86% identity to sjp:SJA_C1-19530)

MetaCyc: 41% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.26

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>GFF4041 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (Sphingobium sp. HT1-2)
MTSIGIFGAAGRMGRAIAQAAAEAGLTVAGGTDRDGSGELVPGVAITNDPLALAQAADVL
IDFSVPAALSANLDACIAANKPILIGTTGLEGEHHALIDQAAARIPVLQTGNTSLGVNLL
AALVEKAAASLGDDWDIEIVEMHHRHKVDAPSGTALLLGEAAAKGRGITLADHSERGRDG
ITGARAKGAIGFAALRGGSVAGDHQVIFATEGERIELGHRAENRSIFARGAIKGARWLAG
QPVGRYDMKGVLGL