Protein Info for PS417_02055 in Pseudomonas simiae WCS417

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF13489: Methyltransf_23" amino acids 27 to 190 (164 residues), 56.6 bits, see alignment E=1.1e-18 PF05175: MTS" amino acids 45 to 155 (111 residues), 25.7 bits, see alignment E=3e-09 PF01209: Ubie_methyltran" amino acids 51 to 155 (105 residues), 43.7 bits, see alignment E=9e-15 PF13847: Methyltransf_31" amino acids 52 to 178 (127 residues), 73.8 bits, see alignment E=5.4e-24 PF08242: Methyltransf_12" amino acids 53 to 148 (96 residues), 56.9 bits, see alignment E=1.1e-18 PF08241: Methyltransf_11" amino acids 53 to 150 (98 residues), 92.5 bits, see alignment E=8.8e-30 PF13649: Methyltransf_25" amino acids 53 to 146 (94 residues), 78.7 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU0425)

Predicted SEED Role

"FIG025233: SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TX65 at UniProt or InterPro

Protein Sequence (244 amino acids)

>PS417_02055 methyltransferase (Pseudomonas simiae WCS417)
MSSQYLSKNYVEETKFGFWFLRSHTWQHHVLRVAINDLRSLFTDSLPEAPVLLDAGCGQG
KSFQYLQQVFAPARLIGLDADPHSLELSREEAKRQGLAIELIGSDCATLQVPDESVDILF
CHQTFHHLVEQHRALKEFYRVLKPGGYLLFAESTEAYIDTWVIRWLFRHPMHVQKSAEEY
LEMIREQGFEFGPQHVSYPYLWWSRSRDFGLLERWGLRKAPPVGQREETLVNCVARKPLA
SAAP