Protein Info for GFF4039 in Xanthobacter sp. DMC5

Annotation: Sodium, potassium, lithium and rubidium/H(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 220 to 252 (33 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 311 to 338 (28 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 394 to 418 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 17 to 419 (403 residues), 162 bits, see alignment E=1e-51 TIGR00831: Na+/H+ antiporter" amino acids 18 to 537 (520 residues), 349.4 bits, see alignment E=1.6e-108

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 51% identity to cak:Caul_3138)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>GFF4039 Sodium, potassium, lithium and rubidium/H(+) antiporter (Xanthobacter sp. DMC5)
MTDIRYILVLLAGVVLTNWMGRVLGDRVALPLIQVAVGAAIGSATSLGVPLKPDQFFLIF
LPPLLFFDGWRVSKTDLAANAPLILSMALGLVVVTVGCVGLMLHWLIPAMPLAVCFALAA
VLSPTDVVAAGAVARHIPIPRGVLRLLEGEALFNDAAALICLRLAIAAVVTGAVPVLDSL
AAFVWAAGGGIAIGIAFSWMVATAKAFMVRRVGEDTSGQILISLLIPYGAYLLAEVAGSS
AVLAAVAAGMMMSRIEVSGRALPLTRLRRGAVWETLQFTLNGVMFLLLGEQMPGILSGAA
RSIAEGGHHAVAWLGLYVAATVLALAALRFAWVLAALCCWPVGRGQGGAPRPFPRWRLVA
VMAFGGVRGAVTLAAALSLPLVLTGGMPFPARDLAVFIAAAVILVSLALANVALPILLRG
IDLPLDLADAEQEREARAEALQAALDALAETAETQTADADAPTVAAIVADHYRHRLDQLR
AEGVDGGTAAWPEERRMHLLAIQAERRSIVSLVQRRRIPIDLAHKLLRETDAEEVALPVA
PGMGEG