Protein Info for PS417_20690 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 20 to 108 (89 residues), 38 bits, see alignment E=8.1e-14 PF00989: PAS" amino acids 21 to 107 (87 residues), 33.8 bits, see alignment E=6.1e-12 PF13426: PAS_9" amino acids 24 to 109 (86 residues), 34.8 bits, see alignment E=3.4e-12 PF08447: PAS_3" amino acids 31 to 111 (81 residues), 52.4 bits, see alignment E=1e-17 PF00015: MCPsignal" amino acids 320 to 485 (166 residues), 154.9 bits, see alignment E=3.8e-49

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 99% identity to pfs:PFLU4551)

Predicted SEED Role

"Aerotaxis receptor Aer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULP9 at UniProt or InterPro

Protein Sequence (521 amino acids)

>PS417_20690 chemotaxis protein (Pseudomonas simiae WCS417)
MRNNQPVTQRERTFPAQQRLISTTDAKGVITYCNDAFVEISGFSRDELVRAPHNLVRHPD
VPPAVFAHMWSTLKQGLPWMGIVKNRCKTGDHYWVNAYVTPVFEGNQVVGYESVRIKPTA
EQIRRAEALYHRINQGKSAIPQRDKWLPVLQDWLPFILVSQLSFMIGASLNSHWGFALAA
GLSVPLGLLGLSWQQRGLKRLLRLAEQTTSDPLIAQMYTDSRGAQARLEMSILSQEARLK
TCLTRLQDTAEHLNDQAAQSNTLAHNSSSGLERQRVETEQVATAVNQMAATTQEVASHVQ
RTADATQEANRLTGRGRDIAGETREAIQRLSVAVGETGVTVTQLAKDSDEIGGVVDVIKG
IADQTNLLALNAAIEAARAGEMGRGFAVVADEVRQLAQRTAESTGQIHALIAKLQQTAAA
AVQTMDAGHRQAEEGVARVMEADQALVGISEAVAHITDMTTQIAAATEEQSSVAEEISRN
ISTIALLADQTSEQAMNSAQLSEELTHTANTQYSLVERFNR