Protein Info for GFF4035 in Xanthobacter sp. DMC5

Annotation: Response regulator protein TmoT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00072: Response_reg" amino acids 1 to 110 (110 residues), 96.3 bits, see alignment E=1.3e-31 PF00196: GerE" amino acids 135 to 191 (57 residues), 79.9 bits, see alignment E=8.6e-27

Best Hits

Swiss-Prot: 64% identical to NODW_BRADU: Nodulation protein W (nodW) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 89% identity to azc:AZC_1361)

Predicted SEED Role

"two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF4035 Response regulator protein TmoT (Xanthobacter sp. DMC5)
VIVVDDDASLRDALSSLFRSIGLEVALFASAAELLAAKLPDAPRCLVLDIRLPGVSGLDF
QAQLARSDMELPIIFMTGHGDIPMSVRAMKAGAVDFLTKPFRDQDMLDAVSAAIEIDRGR
RAERASSSKLRALYDTLTERERQIMALVTSGLMNKQVAAEVGLSEITVKIHRGNVMRKME
AHSLADLVRMAEALGLSAKS