Protein Info for PS417_20645 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 178 to 194 (17 residues), see Phobius details amino acids 200 to 216 (17 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDD3 at UniProt or InterPro

Protein Sequence (483 amino acids)

>PS417_20645 membrane protein (Pseudomonas simiae WCS417)
MSIIDVNQRRAVTSQSKLSALVTVNSSPVSRLVVLLTFVLACAAIAIHAPGQMSMDTSIQ
LYEASLGQSVSWGPPFMSALLRWMGGGELSAALFVMINSVLLYGAFAVVTLTMLQVRAAQ
GLNTIPTWRVVIAFLLIMNPIVFIYVGIVWKDVLFASLLTAACAFAIAATVGSPLRRYCC
IGLSIVLLAAGYQARQQGVFMAPILLLSLMVAVYSFRPTKKVLASSVIIVLFVSVVLGIQ
HQVASSVKGAGDRASSVGFRSIIQFDLAGIVSNSKLPPAEMALPVTQEQLSAIKSAYDPA
RIDFLDLNPVVRAWFASIPSETLRHEWWVMVKQNPGAYLEHRLTTYATLLGLRGLNGTLP
VFVGVEGNPEYLTAAHVRPGTTSRAQVVYDMAVSFFSWPIYRHAFWMLSLIVIVAVGALK
ISPGPVKAIGGVIALATVLMYGSFLPTSLASDFRYLFATIPLVMMLGLILLFGAGEKRVA
EGE