Protein Info for GFF403 in Methylophilus sp. DMC18

Annotation: Sulfate transport system permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 109 to 137 (29 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 23 to 281 (259 residues), 323.4 bits, see alignment E=1.2e-100 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 25 to 283 (259 residues), 413 bits, see alignment E=5.2e-128 PF00528: BPD_transp_1" amino acids 88 to 280 (193 residues), 51.4 bits, see alignment E=5.6e-18

Best Hits

Swiss-Prot: 50% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 82% identity to mfa:Mfla_0610)

MetaCyc: 50% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF403 Sulfate transport system permease protein CysW (Methylophilus sp. DMC18)
MQTTQFQQYQGKVAYKRATSEPTWVRWGLIGLALTFLGLFLLVPLAAVFTEALRKGWDVY
LAAITEADALSAMKLTLIASLISVPLNLVFGVAAAWAITKFDFRGKSFLITLIDLPFAVS
PVIAGLIFVLIFGLQGWFGEWLIDHDLKVVFAVPGIVLATIFVTFPFVARELIPLMQAQG
KEEEEAALVLGASGWKMLWHVTLPNVKWGLIYGVILTNARAMGEFGAVSVVSGHIRGLTN
TMPLHVEILYNEYNYAAAFAVASLLTLLALVTLILKTYVEWQASRDAAAIEKEVTA