Protein Info for PS417_20640 in Pseudomonas simiae WCS417

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 123 to 149 (27 residues), see Phobius details amino acids 160 to 187 (28 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details PF01061: ABC2_membrane" amino acids 25 to 238 (214 residues), 88.3 bits, see alignment E=2.7e-29

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 75% identity to avn:Avin_15960)

Predicted SEED Role

"O-antigen export system permease protein RfbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULN8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PS417_20640 sugar ABC transporter permease (Pseudomonas simiae WCS417)
MNPHAPQPITIGSLLRSLWVNRQLIAQMTRREVIGRYKGSFLGLGWSFLNPLLMLAVYTF
VFSVVFRSRWGIAESGGEESKAMFAVVLFVGMIVYGLFAEILNRAPSLIVGNVNYVKKVV
FPLEILPVVAACAALFHALVSLTVWLMAYTLLIGVPHWHVLFLPLVLFPLLVLALGLAWF
LAALGVFLRDVGQTVAIITTMMMFLAPVFFPVKNLPPEFQPLIMANPLTFIIEQSRDVLI
WGKMPDFMGLLNYFIVALVMFWAGYIWFQKMRKGFSDVL