Protein Info for GFF4028 in Variovorax sp. SCN45

Annotation: Cytochrome c, class I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 394 to 418 (25 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details amino acids 464 to 481 (18 residues), see Phobius details amino acids 502 to 520 (19 residues), see Phobius details amino acids 539 to 560 (22 residues), see Phobius details amino acids 571 to 592 (22 residues), see Phobius details amino acids 622 to 639 (18 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 138 to 217 (80 residues), 41.7 bits, see alignment E=1.8e-14 PF00034: Cytochrom_C" amino acids 140 to 219 (80 residues), 40.7 bits, see alignment E=7.7e-14 PF03239: FTR1" amino acids 337 to 506 (170 residues), 55.7 bits, see alignment E=7.5e-19 amino acids 462 to 597 (136 residues), 63.3 bits, see alignment E=3.5e-21

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 90% identity to dac:Daci_0482)

Predicted SEED Role

"Cytochrome c, class I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (649 amino acids)

>GFF4028 Cytochrome c, class I (Variovorax sp. SCN45)
MKMLSLCARYFLAMAALLALWSSSLAWAADSAASDQAKQTWQLLDYLAVDYGGAVHDGKV
QSASEYEEMKEFAATAAQQLGALPSTPALPDLQQRAKALNELIAAKADAKSVADSAHSLA
AALVKAYPFPLSPSKPPDLARAKVLFEANCAACHGATGRGDGPLGAKLEPPPIAFTDRDR
ARSRSVLALYQVVSQGVSGTSMPSFATLSDEDRWALAFFAGTLSHDDAMRTRGEQSWGKD
VSAKAVFPDLAAAATLTEAALSEQMSPDAARDLTAYVRSHPEATVASSGTGGLSLARTRL
QESLAAARAGDQANATRLGLSAYLDGFEPLEPALRARNQALLTEVENAMLAYRGALASGK
LEQADATAQKLDYLFAQVDGELGADKADPLTTFIASLTILLREGVEALLIVVGMVAFLKK
AERRDVLPYVHGGWIVALVCGGLTWAAATYFVSISGASREVTEGVSSLFAAIVLLSVGLW
MHQKSTAGKWQAYLKEKLSAAMTRRSAWALFALSFIAVYREVFETVLFYSALAGDGNNGA
LLGGLVGGIAILAVIAWLMLRTSARMPIGKFFSLSSILVAVLAVVLAGKGVAGLQEAGWL
SASPIHWLRIEVLGVYPSAETTIAQAVVLVIALAGFALNSMKARQPRMT