Protein Info for PS417_20630 in Pseudomonas simiae WCS417

Annotation: adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to CYSC_AERS4: Adenylyl-sulfate kinase (cysC) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 72% identity to avn:Avin_16180)

MetaCyc: 58% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
assimilatory sulfate reduction I (4/4 steps found)
sulfate activation for sulfonation (2/2 steps found)
assimilatory sulfate reduction IV (3/4 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFQ1 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PS417_20630 adenylylsulfate kinase (Pseudomonas simiae WCS417)
MVNNLVFQASSVSADARATMKGQKPLVLWLTGLSGAGKTTVANAIEIALVERGRHTFLID
GDNVRLGLCRDLGFSDADREENIRRVAEVSRLFVDAGLIVITSFISPFERDRALAREVIG
ADAFMEIFIDAPLSECERRDPKGLYVKARKGLIKKFTGIDSIYEAPLAPDIHLNTLNDDV
ATVVSTVMTYLDERALA