Protein Info for GFF4019 in Variovorax sp. SCN45

Annotation: Arsenical-resistance protein ACR3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 15 to 342 (328 residues), 391.6 bits, see alignment E=1.5e-121 PF13593: SBF_like" amino acids 25 to 332 (308 residues), 28.3 bits, see alignment E=1.2e-10 PF01758: SBF" amino acids 62 to 255 (194 residues), 107.2 bits, see alignment E=8.6e-35

Best Hits

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 82% identity to bpt:Bpet4551)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF4019 Arsenical-resistance protein ACR3 (Variovorax sp. SCN45)
MSAVIESPRASAAPMSVFERYLTVWVFLCIVVGIALGQLFPAAFQAVGRLEVAKVNIPVG
VLIWVMIIPMLLRVDFAALAQMKNHWRGIGVTLFINWAVKPFSMAFLAWLFVRQVFAGSL
PADQLDSYVAGLILLAAAPCTAMVFVWSRLTGGDPVFTLSQVALNDAIMVFAFAPIVGLL
LGLSAITVPWDTLITSVALYIVLPVIFAQLLRKQLLKAGPAAFERAMHRIGPWSIAALLL
TLVLLFAFQGEAIIKQPLVIAMLAVPILIQVVLNSGLAYWLNRKLGEKHNIACPSALIGA
SNFFELAVAAAISLFGFHSGAALATVVGVLIEVPIMLVVVKVVNSSRGWYES