Protein Info for PS417_20555 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16930: Porin_5" amino acids 119 to 293 (175 residues), 111.4 bits, see alignment E=2.2e-36 amino acids 339 to 440 (102 residues), 29.4 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_1424)

Predicted SEED Role

"Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TTD6 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PS417_20555 hypothetical protein (Pseudomonas simiae WCS417)
MRLASTKTAAVLCGGLLLALSVPASAAVDAKLLDMLKANGQITAAQYTELQSELAKDQKE
QQIARQAQQETNEQIAATAKKTNELSSFDQKLAWAAKTQFKGDVRFRQETVKIQGESNNG
GRDKDRQRIRARLGAYTEINSQVDTGIRIATGSSDDARSTNQDQDNYFDKKSIWLDLGYI
DYHPDQIKNLHVIGGKMLQPWVSMGDVIWDSDINPEGLALTYKYPLGSSAELFGSLGNYN
LKDNVDGDGVQFRHDLRLTSGQLGTRFSVTDNLKMTLGGSVYAYQNDKDSRCTTTTTPCA
LAVNGNSADNQFRLYEGFAQADIGGLAVPLAFYGQYVKNNDAVTDQDTAWLIGAKSKVFG
FNLDYNYRDIQRNAVVGAFTDSDFANGTTGSRGHKMKVSYDIDKNFALGATYFLTKADYA
SRTQRDANTNTLQLDAEAKF