Protein Info for GFF4010 in Xanthobacter sp. DMC5

Annotation: Putative 2-aminoethylphosphonate transport system permease protein PhnU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 54 to 82 (29 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 260 (186 residues), 56.3 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 94% identity to xau:Xaut_2151)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF4010 Putative 2-aminoethylphosphonate transport system permease protein PhnU (Xanthobacter sp. DMC5)
MHSADRLARLFLLPLFLFVAAFFLLPMVRLIGVAGSGPNGMAEYVAILTNPRYVATLVAT
LLLSAAVTAATLAIGTVVALFLARNRFWGRPLLVSCLTLPLAFPGVVVGFMVILLAGRQG
LLASLSMGLGMGRWVFAYSMAGLFAGYVYFSLPRVLVTLMAAVEKLDPALEEAARSLGAG
RFEVLRDVTLPGIAPALMASGAIAFATAMGAFGTAFTLATRIDVLAMTIYTEFTLNANFA
TAAALSIALGLITWAVLALSRNLAGSGVAAAG