Protein Info for PS417_20540 in Pseudomonas simiae WCS417

Annotation: multidrug ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 42 to 302 (261 residues), 49.7 bits, see alignment E=4.2e-17 PF00005: ABC_tran" amino acids 380 to 532 (153 residues), 114.5 bits, see alignment E=6.2e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 95% identity to pfs:PFLU4534)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TSJ4 at UniProt or InterPro

Protein Sequence (610 amino acids)

>PS417_20540 multidrug ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MLYRRFEQLIDIFRDAPSAAPPDKVLPFYLYYLRQVWPHFAALLVVGLIGALIEVALFSY
LSRIIDLAQGTPPADFFQVHSTELIWMAVVALLLRPIFGALHDLLVHQTISPGMTSLIRW
QNHSYVLKQSLNFFQNDFAGRIAQRIMQTGNSLRDSAVAAVDAIWHVAIYAISSLVLFAE
ADWRLMIPLVTWIICYGLALRYFVPRVKERSVISSEARSKLMGRIVDGYTNITTLKLFAH
TRYEQEYAKEAIIEQTEKTQLASRVVTSMDIVITTMNGLLIVTTTGLALWLWTQSLISVG
AIALATGLVIRIVNMSGWIMWVVNGIFENIGQVQDGLKTIAQPLAVIDRDNAPRLSVPHG
EVRFEQVDFHYGKKSGIIGGLNLEIKAGEKIGLIGPSGAGKSTLVNLLLRLYDLQGGRIL
IDGQNIADVAQESLREQIGMITQDTSLLHRSIRDNLLYGKPDATDEELWAAVHKARADEF
IPLLSDSEGRTGLDAHVGERGVKLSGGQRQRIAIARVLLKDAPILIMDEATSALDSEVEA
AIQESLETLMQGKTVIAIAHRLSTIARMDRLVVLEKGQIAESGSHAELLAHGGLYARLWQ
HQTGGFVGID