Protein Info for GFF4010 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 174 (28 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 202 (187 residues), 99.4 bits, see alignment E=9.3e-33

Best Hits

KEGG orthology group: None (inferred from 66% identity to bra:BRADO3764)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF4010 Homoserine/homoserine lactone efflux protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNLDTWLIYLLAAAGLSLSPGPNGLLALTHGVLHGQRKTLFTIFGGTLGFVAVIALSMFG
IGALLQTSLVWLTALKWLGGAYLVWLGIQVWRSPPVGVQLTEGDRAGPARSGGSLFRQGA
LSAVTNPKGILFFAAFLPQFIDPHRSLLLQFAIMAGTFALVEAVTELFIAGMAARISPWL
RRVGKRFNQVCGGIFVAIGLALPLRG