Protein Info for GFF4009 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 62 to 88 (27 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 257 (180 residues), 44.6 bits, see alignment E=6.9e-16

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 88% identity to xau:Xaut_2150)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF4009 hypothetical protein (Xanthobacter sp. DMC5)
MKTHRLTFAFQLFVTLLAAAFLMVPAGASILAGFTANYFRGVSSGLTLDWVKQVLALYSD
TIWLSIGIALGTLAATLVLAVPAAWALVRRPSRLARIVEEVVTLPVAVPGLALALALILA
YGAIREFRMSPAFILTGHVLYTLPFMLRSVMAVLAAVDIRSLEEGAASLGASPLQRFFHV
VLPNAKAGILAGALMVVTLSIGEFNLTWMLHTPLTKTLPVGLADSYASMRLEIASAYTLV
FFVMIVPLLLALQLFGRTTGSAR