Protein Info for GFF4008 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 import ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00005: ABC_tran" amino acids 25 to 168 (144 residues), 131.6 bits, see alignment E=4.6e-42 PF08402: TOBE_2" amino acids 278 to 342 (65 residues), 34.6 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 45% identical to FBPC_STRCO: Fe(3+) ions import ATP-binding protein FbpC (fbpC) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 77% identity to xau:Xaut_2149)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>GFF4008 Vitamin B12 import ATP-binding protein BtuD (Xanthobacter sp. DMC5)
MTAPTGAAISIAGCGKTYPDGTRALSPVDLEVKAGETLVLLGPSGCGKTTLLRLIAGLET
PDAGGRIAFDGADVTALPIEKRNVGMVFQSYALFPNMSVIDNVAYGLRVRGVGTETRRAQ
AASVLAMMRIEALAERRIDKLSGGQRQRVALARALAVRPRVLLLDEPLTALDAALREHLR
SEIDALLRRLAITAVYVTHDQAEALALGDRIVVMKNGAIAQVGTPREVYFQPADDYVAGF
VGITNRLEGIVRNGRFETAAGILRVRAPDRAKARLLFRPEAVRLVSPADATLVFQVTQVE
FQGPRQRVTLNAGDGTRIIAEAPADLPLSAGTAIGLVLDANRYSLA