Protein Info for GFF4001 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00638997: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 85 to 98 (14 residues), see Phobius details amino acids 356 to 380 (25 residues), see Phobius details PF17151: CHASE7" amino acids 41 to 226 (186 residues), 300.6 bits, see alignment E=4.3e-94 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 394 to 560 (167 residues), 198.6 bits, see alignment E=3e-63 PF00990: GGDEF" amino acids 398 to 557 (160 residues), 159 bits, see alignment E=9e-51

Best Hits

Swiss-Prot: 100% identical to DGCQ_SALTY: Probable diguanylate cyclase DgcQ (dgcQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to stm:STM1987)

MetaCyc: 66% identical to diguanylate cyclase DgcQ (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00638997: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>GFF4001 FIG00638997: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VPHETLLDNQGWFKKLARRFGPGHVVNTCFLIVMLFSTLLTWREVMILKDAYVASQRNHL
GSVANVLDRQLQFNMDRLIFLRNGMHEALVAPLAFSALQSAVTQFEQRRVRHFWQLELDK
RRTLPLYGVSDQFVARTTLLSRESRDLANELTATLELGYLARLARSSAMLALETMYVSRS
GFYLSTLPTAYGSDIVSRYYQYVTQPWFIEQSQRRNSQRGVRWFTSAQPYVTDEQKKVTA
SLPLDHDNYWYGVLAMDIPVASLQRFLRDAAEKDIEGEYQLYDNHLRLLTDSAPEQQTAN
TLNDRERALLAREIEKDTLGGLRLGTHYVSWERLDHFDGILLRVHTLREGIQGNFGSISI
ALTLLWGLFTAMLLISWGVIRHMVKNMFVLQNSLQWQAWHDPLTRLYNRGALFEKASRLA
KRYREARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTIRAHDIAGRVGGEE
FCIVLPGATKAQALQIAERIRQRINDKEILVTKSTTLRISASMGISSAEEYGDYDFEQLQ
SLADKRLYYAKQSGRNRICASDATQEREKK