Protein Info for GFF4000 in Hydrogenophaga sp. GW460-11-11-14-LB1
Annotation: Cobalamin synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to COBS_LEPCP: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 62% identity to aaa:Acav_0880)Predicted SEED Role
"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis
MetaCyc Pathways
- adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
- 2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
- benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
- 4-methylphenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
- phenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
- adenosylcobalamin biosynthesis from adenosylcobinamide-GDP II (2/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.8.26
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (270 amino acids)
>GFF4000 Cobalamin synthase (Hydrogenophaga sp. GW460-11-11-14-LB1) MSAFARHFLLALQFFTRIPVTGRLAAWVGFSPAMLRASAAHFPGVGWVVGGLAAAVLWGL LALLPPVPAALWVAVVLSTVFSVMLTGAFHEDGLADLADGLGGSAQRERALEIMKDSRIG SYGAIALVLVLLTKVALLALLAQGSGWLAVVALFAAHVTSRTLPLLIIRTLPHVGDTPQS KSKPLAESLSNAGLIAGLVWWALAMALAGWLLPGAPWWAAVLGALVGLAWMWRLLHRRLQ GFTGDGLGATQQVGEVGFYLGLALALPVLA