Protein Info for GFF4000 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cobalamin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 13 to 30 (18 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details PF02654: CobS" amino acids 11 to 260 (250 residues), 182.5 bits, see alignment E=5.9e-58

Best Hits

Swiss-Prot: 51% identical to COBS_LEPCP: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 62% identity to aaa:Acav_0880)

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF4000 Cobalamin synthase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAFARHFLLALQFFTRIPVTGRLAAWVGFSPAMLRASAAHFPGVGWVVGGLAAAVLWGL
LALLPPVPAALWVAVVLSTVFSVMLTGAFHEDGLADLADGLGGSAQRERALEIMKDSRIG
SYGAIALVLVLLTKVALLALLAQGSGWLAVVALFAAHVTSRTLPLLIIRTLPHVGDTPQS
KSKPLAESLSNAGLIAGLVWWALAMALAGWLLPGAPWWAAVLGALVGLAWMWRLLHRRLQ
GFTGDGLGATQQVGEVGFYLGLALALPVLA