Protein Info for GFF4 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Quinolinate synthetase (EC 2.5.1.72)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 27 to 341 (315 residues), 407.9 bits, see alignment E=1.3e-126 PF02445: NadA" amino acids 31 to 340 (310 residues), 349.8 bits, see alignment E=5.8e-109

Best Hits

Swiss-Prot: 100% identical to NADA_SALTY: Quinolinate synthase A (nadA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 99% identity to sed:SeD_A0851)

MetaCyc: 89% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF4 Quinolinate synthetase (EC 2.5.1.72) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSVMFDPQAAIYPFPPKPTPLNDDEKQFYREKIKRLLKERNAVMVAHYYTDPEIQQLAEE
TGGCISDSLEMARFGTKHAASTLLVAGVRFMGETAKILSPEKTILMPTLAAECSLDLGCP
IDEFSAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELIEHLDSLGEKIIWAPDRH
LGNYVQKQTGADVLCWQGACIVHDEFKTQALTRLKKIYPDAALLVHPESPQSIVEMADAV
GSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPEKELLEAPTAGEGATCRSCAHCPWM
AMNGLKAIAEGLEQGGAAHEIQVDAALREGALLPLNRMLDFAATLRA