Protein Info for GFF3996 in Xanthobacter sp. DMC5

Annotation: putative acetoacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 78% identical to ADC1_BRADU: Probable acetoacetate decarboxylase 1 (adc1) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01574, acetoacetate decarboxylase [EC: 4.1.1.4] (inferred from 87% identity to xau:Xaut_2132)

MetaCyc: 55% identical to acetoacetate decarboxylase monomer (Clostridium acetobutylicum ATCC 824)
Acetoacetate decarboxylase. [EC: 4.1.1.4]

Predicted SEED Role

"Acetoacetate decarboxylase (EC 4.1.1.4)" (EC 4.1.1.4)

MetaCyc Pathways

ketogenesis (4/5 steps found)
pyruvate fermentation to acetone (4/5 steps found)
isopropanol biosynthesis (engineered) (3/5 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF3996 putative acetoacetate decarboxylase (Xanthobacter sp. DMC5)
MKIADVRRTAYSMPLTNPSFPPGPYRFIDREYMIITYRTDPEALAKVVPEPLEITEPVVK
YEFIRMPDSTGFGDYTETGQVIPVRFNGQEGGYVHSMYLDDESPIAGGRELWGFPKKYAQ
PKLKVETDTLVGTLHYGSVLCASATMGYKWVAGDKEKILASLLTPSFLLKIIPDVDATPR
ICELVRYYLVDVTLKECWVGPGALGLFPHALCNVAALPVLEVLSAVHIKADLTLGLGEVV
YDYMKENGA