Protein Info for PS417_20460 in Pseudomonas simiae WCS417

Annotation: chromosome segregation protein SMC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 721 PF13175: AAA_15" amino acids 1 to 88 (88 residues), 48.6 bits, see alignment E=3e-16 PF11398: DUF2813" amino acids 1 to 86 (86 residues), 32.7 bits, see alignment E=1.7e-11 PF13476: AAA_23" amino acids 6 to 55 (50 residues), 46.8 bits, see alignment 1.7e-15 PF13304: AAA_21" amino acids 284 to 336 (53 residues), 28.7 bits, see alignment 4.3e-10 PF20469: OLD-like_TOPRIM" amino acids 447 to 518 (72 residues), 58.1 bits, see alignment E=3.3e-19

Best Hits

Predicted SEED Role

"FIG131328: Predicted ATP-dependent endonuclease of the OLD family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJ16 at UniProt or InterPro

Protein Sequence (721 amino acids)

>PS417_20460 chromosome segregation protein SMC (Pseudomonas simiae WCS417)
MYLSALKVQNFRQFGADTNGLVIEFTKGVTALVGENDAGKSSVIDALRFVLQTRDGEYVR
LQPEDFHIPMEGPQASQITIIAKFSDLSVADQGALSEYVTFNGGAAVVYIHWTARRLTDD
ALARRWVDIAVRSGHSGGGPSIDTNVRQLLAAAYLRPLRDATREMSPGRGSRLSQVLKNF
PSIKDGTGFDIDNPLENPASLSLAGLAGYLRHLVNLHPGVAAAQDSVNDNYLSHLSLEGD
ELHGRINFVEGISESARLRQILERMELSLLDQGSREGRGEYGLGSNNLLFMACELLLLGK
EPDGLPLLLIEEPEAHLHPQRQLRLMEFLTAAATPKPSLLTVTQPMAVDEREEDTLPWSE
GTEVLSALSSGEDGSTANEVNQESETRPVQVILTTHSPNLSSKIALDNLVLMHGRKAYSL
GKKHTKLDKGDYRFLARFLDVTKANLFFARGLLIVEGDAEAILLPALAKMLGRDLTRHGV
SVTNVGGVGLGRYARILQRAHPEHGILKIPVACISDMDVMPDCAPQILGLVENDDDPKWG
GGRRKWRAIRDFGADEETRLRRLAEWRNSRKANDEQNVQTFVAGQWTLEYDLAFSGMARE
LLVAARLAANDDAIHAARKTHDEVITLAISEYEGFQNSGMTAEQICSTIYDLFHRKIASK
AITAQYLVEIMEQRYQRIVVRPDGLAERLPGYLVEAITYVTSRMDIPQSQPSQQQSQSQT
P