Protein Info for GFF399 in Sphingobium sp. HT1-2

Annotation: Translation initiation factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR00168: translation initiation factor IF-3" amino acids 17 to 177 (161 residues), 203.8 bits, see alignment E=7e-65 PF05198: IF3_N" amino acids 17 to 83 (67 residues), 100.6 bits, see alignment E=4.5e-33 PF00707: IF3_C" amino acids 93 to 177 (85 residues), 129.8 bits, see alignment E=2.9e-42

Best Hits

Swiss-Prot: 75% identical to IF3_ZYMMO: Translation initiation factor IF-3 (infC) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 92% identity to sjp:SJA_C1-07910)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>GFF399 Translation initiation factor 3 (Sphingobium sp. HT1-2)
MMRRPLAPPPKSGPRYNEFITVPKVRVIDDEGENLGVMFTQEAIEQAADVGLDLVEVSPN
ADPPVCKFLDIGKFKYEAQKKANIARKTQKTQELKEIKMRPNIDDHDYDTKMKKVHDFIG
DGDKVKITLRFRGRELSHQQLGMNLLQRVAENVAEIAKVEAYPRMEGRQMLMVLSPK