Protein Info for PS417_20415 in Pseudomonas simiae WCS417

Annotation: reverse transcriptase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00078: RVT_1" amino acids 155 to 311 (157 residues), 50.7 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 41% identity to ddd:Dda3937_02707)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPT6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_20415 reverse transcriptase (Pseudomonas simiae WCS417)
MDQSFSIKNLNDLLKGDREKGGDLEERYIPAAFDIRVKLYELNKLKSFSRYRFRTGKITP
AFYEKRMSRLTMVIDKRKIQHGRLVDFELERVSKIVSGKEFRINVALLPALVGGKKVYGV
GNSLEQVLAIRFVQRALKVLYELRMPPRDILVSQIKSLALDGVPKYIIRSDVESFYESVR
HKELLDGIHQAPELSVLIKRILTRLMKDYVVVSGDENGLPRGIGISAYLSEIYLSSIDAE
IRRQDNLFYYARYVDDMVLMYAPQRKELAAKYLETLSEILDGKGLKFNDKTKPIDLLEGF
KGKFDYLGYTFDLSSSSSGVQLSQRKINKYRSRIDKAFSDYNSKFTFIPKKSEEELVLRC
LFLTGNMRLFNRKSNAFIGIYFSNKYITDTSQLSGLDHYFRNKIKGVASPSLTRKLSKLS
FEKGFKEKLFRNFDSKQLSELSRGWKHV