Protein Info for GFF3983 in Xanthobacter sp. DMC5

Annotation: Acyl-CoA thioesterase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00189: acyl-CoA thioesterase II" amino acids 15 to 285 (271 residues), 306 bits, see alignment E=1.3e-95 PF13622: 4HBT_3" amino acids 32 to 112 (81 residues), 76.7 bits, see alignment E=2e-25 PF02551: Acyl_CoA_thio" amino acids 157 to 283 (127 residues), 117.5 bits, see alignment E=5.9e-38 PF20789: 4HBT_3C" amino acids 170 to 284 (115 residues), 86.3 bits, see alignment E=3.5e-28

Best Hits

Swiss-Prot: 41% identical to TESB_HAEIN: Acyl-CoA thioesterase 2 (tesB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 84% identity to xau:Xaut_2210)

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF3983 Acyl-CoA thioesterase 2 (Xanthobacter sp. DMC5)
MTAQNPDVDKLLGILDLEPLEINLFRGRSASPTGGRVFGGQVIAQALVAARRTVEDARVT
HSLHGYFLLGGDPTVPIIYDVDRIRDGRSFTTRRVVAIQHGEAIFSMSVSFQKPEEGFTH
QSQMPEVPQPEDLPGDEVWRDRLLARFPGAAGRDWMAHRPLEVKPTSLDMAYLGSPGARP
SIWIRARGPLPDDLPIHQAVLAYASDLSLLQAALLPHGKSVFDTDVQVASLDHALWFHRP
FRADDWLLYTQESPAASAGRGFCRGELFTRDGILVASAAQEGLMRPVTPRA