Protein Info for GFF3982 in Variovorax sp. SCN45

Annotation: Branched-chain amino acid ABC transporter, permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 279 to 308 (30 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 108 to 331 (224 residues), 65.5 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: None (inferred from 98% identity to vap:Vapar_1505)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>GFF3982 Branched-chain amino acid ABC transporter, permease protein LivH (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MTWDVALILLTDGLANGAVYLLAGLGLVLIFSVTRVVFVPFGDIAAFAALSLAAFETDRV
PPTIGMVAVLAALALATEVGSLLRRGEAKRIPKAVLMWGVLPAIPCVLAWLAARPGVPVA
VHIAVAVLLVVPIAPLLARVVFQPIADASVLVLLIVSLALHFLLSGLGLLFFGPEGSRTT
PLTSAVFTLSDGFTVSGQVVLMVGAAIVLSGLFFLVFERTVAGKALRATAVNRVGARLVG
IRPVRTALLAYGCASLLAGLIGVLIAPVTTMYYDSGFIIGLKAFVAAIIGGLVSYPMTAV
GALAVGVVESFASFWSGALKDVIVFSLLIPVLMLRSFMAAHAEEEEDEVDQ