Protein Info for GFF3981 in Xanthobacter sp. DMC5

Annotation: putative ABC transporter ATP-binding protein YheS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 PF00005: ABC_tran" amino acids 18 to 175 (158 residues), 82 bits, see alignment E=3.5e-26 amino acids 327 to 458 (132 residues), 75.8 bits, see alignment E=3e-24 PF12848: ABC_tran_Xtn" amino acids 214 to 294 (81 residues), 85.1 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 42% identical to Y658_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_0658 (HI_0658) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 90% identity to xau:Xaut_2091)

Predicted SEED Role

"ABC transporter, duplicated ATPase domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>GFF3981 putative ABC transporter ATP-binding protein YheS (Xanthobacter sp. DMC5)
MIVLDDISLRLAGRLLIDHASVALPENARVGVVGRNGSGKTTLFKALVGELELESGAIRL
PNRTRIGRVAQEAPAGPDSLIDRVLAADTERAALLKERETTQDPNRMGEIEMRLLDIGAH
AAPARAATILAGLGFDESAQQRPCSEFSGGWRMRVALAALLFTEPDLLLLDEPTNYLDLE
GTLWLQDYLAHYPRTVILISHDRDLLDESVDHILHLTGQKLTLYKGGFTSFDRQRRERLL
LDQKARKKQEMQRAHMESFVARFRAKATKAKQAQSRLKALARMEPLAAQVSEEAAAISIR
HPEKLLSPPIVVLEKVAVGYVPGRPILQNLNLRIDEDDRIALLGPNGNGKSTFAKLLADR
LKEESGRVVRADKLEVAYLAQHQIDELIPGDSPAQHVRRLMPAAPEARVRARAAEMGFSG
GAADTKVSSLSGGEKARLLLGLATFHGPHLLILDEPTNHLDIEARAALIEAINDFPGAVI
LVSHDRHLLEACAERLWRVSGGTVKAYDGDLDQYKAEVLSRSDGDRMTDKGRKDRSETKA
EAAPAPRRIATGPLKKRIRELEGAVDKLTKQIEGLDAKLSDAGLHAAKPLDAARFAKERA
EAAEKLAQAEEEWLEVSAELEAAGG