Protein Info for GFF3977 in Variovorax sp. SCN45

Annotation: ABC transporter, substrate-binding protein (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 30 to 242 (213 residues), 38.8 bits, see alignment E=9.6e-14 PF13458: Peripla_BP_6" amino acids 30 to 344 (315 residues), 182 bits, see alignment E=3.9e-57 PF01094: ANF_receptor" amino acids 63 to 242 (180 residues), 58.9 bits, see alignment E=6.9e-20

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 86% identity to vap:Vapar_1500)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, periplasmic amino acid- binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF3977 ABC transporter, substrate-binding protein (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MKVMNRIRTLAAVAVGLGALSAASAWAADLKVGFITSLSGPVSSLGIPYDKGMKAAVAYK
SEVGGRKVQVIQLDDASDPSTAARNARKLIEEDKVDVIIGTAGAPGSLAIAGVARETKTP
LISIANADLAGEEGAWMVTLPQPAPLMMGAMVEKMKQAGVKTVAYIGYSDAWGDLVYDAL
MKSAPAAGIKVVSNERYARSDSSVAGQVLKIVALRPDAVITGASGTPGALPYLALAERGY
KGKIYGMHSLINPDFIRVGGPSVEGLLAPTGPVVVAEQLPDSNPMKKIAMDFRTAYQKAN
GAPPTDTFSAYSFDAWLIYLDAAQRALASKAEPGTPQFRLALRDAIVSTKELVGTHSVYN
FKPTDRYGSDDRSRVVVKLEKGQWKLVP