Protein Info for GFF3974 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 70 to 90 (21 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 241 to 269 (29 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 145 to 317 (173 residues), 94.4 bits, see alignment E=3.7e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 83% identity to xau:Xaut_2085)

Predicted SEED Role

"Organosulfonate ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF3974 hypothetical protein (Xanthobacter sp. DMC5)
MNSIAMKPAAKSAPIAAPFHLASDGGLHRPAAPGHIVLRPERDAVAAMPVPDRSFTGRAR
RWLKLNAHTIRAMLLGALAIGLFILAWHVVTVNRMTFYVRFLNVPSPEQVLESARTAFST
GAFLNHIYISCRRIFIGFALAAVVAVPLGLLMGRFQLLKEFVFPVSEVLRPIPAIAWVPM
SIMLWPTNEESIVFITFLGSFFPILLNTLHGMANVDEVLVRAARCLGATERATFREVYFP
AVLPQVFTGLTVGMGVAWVSLIAAEMISGQFGIGYFTWEAYSLVQYPDIALGMITIGVLG
LASSFLIRIAGRAVTPWSRAK