Protein Info for GFF3968 in Xanthobacter sp. DMC5

Annotation: ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 TIGR01039: ATP synthase F1, beta subunit" amino acids 5 to 473 (469 residues), 824.6 bits, see alignment E=1.2e-252 PF02874: ATP-synt_ab_N" amino acids 8 to 74 (67 residues), 71.1 bits, see alignment E=1.4e-23 PF00006: ATP-synt_ab" amino acids 131 to 355 (225 residues), 234.1 bits, see alignment E=2.2e-73 PF22919: ATP-synt_VA_C" amino acids 363 to 427 (65 residues), 59.7 bits, see alignment E=3.5e-20

Best Hits

Swiss-Prot: 95% identical to ATPB_AZOC5: ATP synthase subunit beta (atpD) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 95% identity to azc:AZC_4125)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>GFF3968 ATP synthase subunit beta (Xanthobacter sp. DMC5)
MANPTGRITQVIGAVVDVQFDGHLPEILNALETTNHGNRLVLEVAQHLGENTVRTIAMDA
TEGLVRGQGVTDTGAPIQVPVGDATLGRIMNVIGEPVDELGPVVGDGLRAIHQPAPSYAD
QSTEAEILVTGIKVVDLLAPYSKGGKIGLFGGAGVGKTVLIMELINNIAKAHGGYSVFAG
VGERTREGNDLYHEMIESKVNVDPHEHGGSAAGSKCALVYGQMNEPPGARARVALTGLTV
AEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGALQERITTTT
KGSITSVQAIYVPADDLTDPAPAASFAHLDATTVLSRSIAEKGIYPAVDPLDSTSRILSP
LVIGEEHYNVARQVQQTLQRYKALQDIIAILGMDELSEEDKLTVARARKIERFLSQPFHV
AEVFTGSPGKLVDLKDTISGFKGLVEGKYDYLPEQAFYMVGSIDEAIEKGKKLAAEAA