Protein Info for GFF3965 in Xanthobacter sp. DMC5

Annotation: ATP synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR01145: ATP synthase F1, delta subunit" amino acids 10 to 178 (169 residues), 123.6 bits, see alignment E=5.1e-40 PF00213: OSCP" amino acids 10 to 180 (171 residues), 175 bits, see alignment E=7.7e-56

Best Hits

Swiss-Prot: 91% identical to ATPD_XANP2: ATP synthase subunit delta (atpH) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 91% identity to xau:Xaut_2077)

MetaCyc: 34% identical to ATP synthase oligomycin sensitivity conferral protein, mitochondrial precursor (Homo sapiens)
ATPSYN-RXN [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>GFF3965 ATP synthase subunit delta (Xanthobacter sp. DMC5)
VADTIVSGMAGRYATALFELASEAGAIDSVKADLDRLSAMIAESADLARLVKSPVFSAEA
QLKAIAAVLGQAGISGLAGNFVKLVAQNRRLFALPKMISDYAALVAAQRGETTAQVTVAA
PLSDTHFAALKDALAQQTGKDVNLDVTVDPSILGGLIVKLGSRMVDASLKTKLNSIRHAM
KEVR