Protein Info for GFF3964 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transmembrane component CbiQ of energizing module of cobalt ECF transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 22 to 55 (34 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF02361: CbiQ" amino acids 10 to 222 (213 residues), 207 bits, see alignment E=1.4e-65 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 16 to 216 (201 residues), 193.9 bits, see alignment E=1.4e-61

Best Hits

Swiss-Prot: 100% identical to CBIQ_SALTY: Cobalt transport protein CbiQ (cbiQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 98% identity to set:SEN2019)

Predicted SEED Role

"Transmembrane component CbiQ of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF3964 Transmembrane component CbiQ of energizing module of cobalt ECF transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTGLDRLSYQSRWAHVAPQRKFLLWLAMMILAFVLPPVGQGIELLIIAGLSCWLLRISLW
RWCRWMAIPFGFLLVGVITIIFSISREPQMLLAGISVGPYWIGITRAGVVTANETFWRSL
TALSATLWLVMNLPFPQLISLLKRAHIPRLLTEQILLTWRFLFILLDEAVAIRRAQTLRF
GYCSLPNGYRSLAMLAGLLFTRVLMRYQQMTTTLDIKLYQGDFHL