Protein Info for GFF3960 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sirohydrochlorin cobaltochelatase CbiK (EC 4.99.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to CBIK_SALTY: Sirohydrochlorin cobaltochelatase (cbiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02190, sirohydrochlorin cobaltochelatase [EC: 4.99.1.3] (inferred from 99% identity to spt:SPA0846)

MetaCyc: 100% identical to sirohydrochlorin cobaltochelatase monomer (Salmonella enterica enterica serovar Typhimurium)
Sirohydrochlorin cobaltochelatase. [EC: 4.99.1.3]

Predicted SEED Role

"Sirohydrochlorin cobaltochelatase CbiK (EC 4.99.1.3)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.99.1.3)

MetaCyc Pathways

adenosylcobalamin biosynthesis I (anaerobic) (31/36 steps found)
cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
siroheme biosynthesis (4/4 steps found)
factor 430 biosynthesis (3/7 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF3960 Sirohydrochlorin cobaltochelatase CbiK (EC 4.99.1.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKALLVVSFGTSYHDTCEKNIVACERDLAASCPDRDLFRAFTSGMIIRKLRQRDGIDID
TPLQALQKLAAQGYQDVAIQSLHIINGDEYEKIVREVQLLRPLFTRLTLGVPLLSSHNDY
VQLMQALRQQMPSLRQTEKVVFMGHGASHHAFAAYACLDHMMTAQRFPARVGAVESYPEV
DILIDSLRDEGVTGVHLMPLMLVAGDHAINDMASDDGDSWKMRFNAAGIPATPWLSGLGE
NPAIRAMFVAHLHQALNMAVEEAA