Protein Info for PS417_02015 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 290 (248 residues), 112.1 bits, see alignment E=4.2e-36 amino acids 268 to 417 (150 residues), 43.1 bits, see alignment E=4e-15 PF12832: MFS_1_like" amino acids 48 to 388 (341 residues), 31.2 bits, see alignment E=1.9e-11 PF00083: Sugar_tr" amino acids 72 to 220 (149 residues), 42.6 bits, see alignment E=5.8e-15

Best Hits

Swiss-Prot: 62% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 98% identity to pfs:PFLU0417)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEU1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>PS417_02015 membrane protein (Pseudomonas simiae WCS417)
MNSAVAPLAQEVPPTALDEVVAQLNDAYIEKGTPMFMRTVLALFSGGFATFALLYCVQPM
MPALSHEFSINAAQSSLILSVSTAMLALGLLITGPISDTLGRKPVMVAALFCAAFATIAS
GLMPSWEGILFMRALVGLSLSGLAAVAMTYLSEEIHPQHIGLAMGLYIGGNAIGGMSGRL
IIGVLIDFVSWHTAMLIIGALALIAATVFWKILPESRNFRASSLKPRSLVDSFVMHFKDA
GLPWLFLEAFLLMGAFVTMFNYIGYRLLADPYDLSQAVVGLLSLVYLSGIYSSAKIGSLA
DRLGRRRVLWATIVLMLAGMLLTLFSPLWLVVPGMLIFTFGFFGAHSVASSWIGRRAVKA
KGQASSLYLFCYYVGSSIAGTAGGFFWHFAGWNGIGAFIVALLMGALLVALKLAKLPPLG
IVKA