Protein Info for PS417_20275 in Pseudomonas simiae WCS417

Annotation: RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00270: DEAD" amino acids 24 to 192 (169 residues), 151.2 bits, see alignment E=3.5e-48 PF04851: ResIII" amino acids 39 to 185 (147 residues), 33.4 bits, see alignment E=6.1e-12 PF00271: Helicase_C" amino acids 231 to 338 (108 residues), 99.5 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 40% identical to RHLE_ECOLI: ATP-dependent RNA helicase RhlE (rhlE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU4526)

MetaCyc: 40% identical to ATP-dependent RNA helicase RhlE (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase SrmB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UYQ1 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_20275 RNA helicase (Pseudomonas simiae WCS417)
MFSQFALHERLLKAVAELKFVEPTPVQAAAIPLALEGRDLRVTAQTGSGKTAAFVLPVLN
RLIGPAKVRVSIKTLILLPTRELAQQTLKEVERFSQFTFIKSGIITGGEDFKVQAAMLRK
VPDILIGTPGRMIEQLNAGNLDLKEVEVLVLDEADRMLDMGFADDVQRLVSECVNRQQTM
LFSATTGGSTLREMVAKVLNNPEHLQVNNVSDLNATTRQQIVTADHNVHKEQILNWLLAN
ETYQKAIVFTNTRAAADRIYGRLVAQEYKAFVLHGEKDQKDRKLAIDRLKAGGVKILVAT
DVAARGLDVDGLDLVINFDMPRSGDEYVHRIGRTGRAGNDGLAISLICHGDWNLMSSIER
YLKQSFERRTIKEVKGTYTGPKKVKASGKAVGVKKKKTDAKGDKKKTGAKSPTKRKIANR
PKTDNLSLVSKDGMAPLKRRKPEAPAAE