Protein Info for GFF3959 in Variovorax sp. SCN45

Annotation: Uncharacterized integral membrane endopeptidase Bmul_2226

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 29 to 207 (179 residues), 216.4 bits, see alignment E=2.9e-68 PF01435: Peptidase_M48" amino acids 211 to 417 (207 residues), 118.1 bits, see alignment E=4.2e-38

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 94% identity to vpe:Varpa_1638)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>GFF3959 Uncharacterized integral membrane endopeptidase Bmul_2226 (Variovorax sp. SCN45)
MSYSLIFTIAFAVALVAGLLVKFWLASRQVRHVARHRGTVPAAFAQTITLAAHQKAADYT
IAKARFGLIEMAWGTALLLGWTLLGGLDMLNKLLLAWIGGGMVQQLALLAAFAAIGGLLE
LPFTLWQTFRLEERFGFNKMTWKLWLADTVKSTLLGAVIGLPIAALILWLMSAAGQLWWL
WAWGAWMGFNLLLMLIYPTFIAPLFNKFKPLDDPTLKARVTALMKRCGFAAKGLFVMDGS
TRSAHANAYFTGFGASKRVVFYDTLLRQLNAGEVEAVLAHELGHFKHRHIVKRLVAMFAL
SLAGFALLGWVSTQVWFYTGLGVQPNMAAPNSALALLLFMLAVPVFGFFVAPLPARLSRK
HEFEADAYAVAQTSGADLSAALLKLYQDNASTLTPDPVFVSFYYSHPPASERLARMTAA