Protein Info for GFF3953 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 28 (5 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 229 to 235 (7 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details PF00892: EamA" amino acids 11 to 138 (128 residues), 45.2 bits, see alignment E=5.9e-16 amino acids 151 to 283 (133 residues), 50 bits, see alignment E=1.9e-17

Best Hits

KEGG orthology group: None (inferred from 82% identity to xau:Xaut_2065)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF3953 hypothetical protein (Xanthobacter sp. DMC5)
VSKNPSLTLAFGTLMLTLGALAMGASVLFVRLADVGPFASAFWRVALALPPLALWAALAE
GTRAFRPDRLSLLAGAFFAGDLFFWHLAILGTTVANATVLATTSPLWITAFAVLVLRQRV
SRDGLIGLALCIAGALALVGRSWQFDPQHLPGDAAGLATAVFFAGYFLAVSRARASRGAA
AITLVSTATTALILLAVALMAEPTLWPASAGGLAALVALALVSQVGGQGLMAVGLASVPP
AFGALVFFLEVASAAALGALLLDEPITALQAAGGALILAGIVVARPRARTARAGEVGMET
SGTGYREGRH