Protein Info for GFF3950 in Sphingobium sp. HT1-2

Annotation: RND efflux system, membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 34 to 368 (335 residues), 263.1 bits, see alignment E=1.5e-82 PF25917: BSH_RND" amino acids 58 to 201 (144 residues), 74.9 bits, see alignment E=7.6e-25 PF25876: HH_MFP_RND" amino acids 99 to 168 (70 residues), 54.5 bits, see alignment E=2.4e-18 PF25944: Beta-barrel_RND" amino acids 206 to 292 (87 residues), 85.5 bits, see alignment E=5.3e-28 PF25967: RND-MFP_C" amino acids 297 to 357 (61 residues), 77.2 bits, see alignment E=1.5e-25

Best Hits

Swiss-Prot: 51% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 79% identity to sjp:SJA_C1-20440)

MetaCyc: 51% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF3950 RND efflux system, membrane fusion protein (Sphingobium sp. HT1-2)
MQKGNFFGLLACVSALALSACGQEAPPAPPPPSVGVVTLKTESAPLLNELPGRISAFETA
EVRPQISGVIRRRLFTEGGTVQAGQLLYEIEDAPYRAALAQAQGSLANAQAAIRSTGLQA
QRYKDLVGINAVSKQEYDDAAAAAQQARANVAAQQGAVQAAQVNQNFTRIRAPISGRIGR
SLLTPGALVQTGQADPLTTIQRTDRVYVDVTQSAAQIIDLKQAMKAGGISEAQGARIQLI
LPNGSVYPGEGRLQFADVTVDSSSGAVTLRAIFPNADGLLLPGMYVRAKLIEGERTQAIL
APQQGISRDARGRATAMVVGKDNKVEMRQVTVDRAIGDKWIVTSGLKPGDQLIVEGLVNL
RPGTVVKPGAPQQVTAPEGGAKPAAAQGASNAGEAH