Protein Info for GFF3946 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Propanediol utilization polyhedral body protein PduB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR04501: microcompartment protein PduB" amino acids 46 to 270 (225 residues), 397.3 bits, see alignment E=9.2e-124 PF00936: BMC" amino acids 80 to 153 (74 residues), 37.8 bits, see alignment E=7.9e-14 amino acids 186 to 255 (70 residues), 55.6 bits, see alignment E=2.1e-19

Best Hits

Swiss-Prot: 100% identical to PDUB_SALTY: Propanediol utilization protein PduB (pduB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sew:SeSA_A2209)

Predicted SEED Role

"Propanediol utilization polyhedral body protein PduB" in subsystem Propanediol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF3946 Propanediol utilization polyhedral body protein PduB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSSNELVEQIMAQVIARVATPEQQAIPGQPQPIRETAMAEKSCSLTEFVGTAIGDTLGLV
IANVDTALLDAMKLEKRYRSIGILGARTGAGPHIMAADEAVKATNTEVVSIELPRDTKGG
AGHGSLIILGGNDVSDVKRGIEVALKELDRTFGDVYGNEAGHIELQYTARASYALEKAFG
APIGRACGIIVGAPASVGVLMADTALKSANVEVVAYSSPAHGTSFSNEAILVISGDSGAV
RQAVTSAREIGKTVLATLGSEPKNDRPSYI