Protein Info for GFF3942 in Variovorax sp. SCN45

Annotation: DnaA inactivator Hda (shorter homolog of DnaA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR03420: DnaA regulatory inactivator Hda" amino acids 27 to 250 (224 residues), 217.4 bits, see alignment E=9.1e-69 PF22688: Hda_lid" amino acids 186 to 249 (64 residues), 73.8 bits, see alignment E=8.9e-25

Best Hits

KEGG orthology group: K10763, DnaA-homolog protein (inferred from 98% identity to vpe:Varpa_1622)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF3942 DnaA inactivator Hda (shorter homolog of DnaA) (Variovorax sp. SCN45)
MLAGPIEFLTILRALAAPSMNLPGMKQLALDIGIATGPSFDAFFAGPNEAALRHLQVWVG
GAGAPALHSPVPTYLWGEGGSGKTHLLESVRVALREQGASVGWLHAGLLEPPEFDERWGA
VLLDDVHLYTAVQQHAAFNWFVNAQTLQRGVVAAGALPPADLPLREDLRTRLGWGHVFHL
QVLSESERRAVLRQAADARGVMLSDDVLDYMLHRFSRDLGSLMELLSQLDGYALQTQRAI
TIPLIRSMLENE