Protein Info for GFF3941 in Sphingobium sp. HT1-2

Annotation: Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.128)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13673: Acetyltransf_10" amino acids 43 to 135 (93 residues), 50.4 bits, see alignment E=4.5e-17 PF00583: Acetyltransf_1" amino acids 51 to 131 (81 residues), 47.9 bits, see alignment E=3.1e-16 PF13508: Acetyltransf_7" amino acids 55 to 132 (78 residues), 47 bits, see alignment E=5.6e-16 PF08445: FR47" amino acids 74 to 134 (61 residues), 24.7 bits, see alignment E=3.7e-09

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 84% identity to sjp:SJA_C1-20520)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>GFF3941 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.128) (Sphingobium sp. HT1-2)
MIPAGLTLDTYDEGERNALGDAMEVMTRAFDPLFGEAWTLPQLSGVMTMPGTWLTVAHVD
AAPLGFALVRSVLDECELLLLAVDPLWRGRGIGRSLLGHSLTLARRRGITSMNLEVRASN
MAVKLYETIGFEYVHRRPGYYRGNDGKLHDALSFRIDMLV