Protein Info for GFF3937 in Sphingobium sp. HT1-2

Annotation: tRNA-i(6)A37 methylthiotransferase (EC 2.8.4.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 17 to 446 (430 residues), 472.9 bits, see alignment E=8.8e-146 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 18 to 448 (431 residues), 471.6 bits, see alignment E=2.7e-145 PF00919: UPF0004" amino acids 18 to 114 (97 residues), 99 bits, see alignment E=2e-32 PF04055: Radical_SAM" amino acids 162 to 333 (172 residues), 95.6 bits, see alignment E=5.8e-31 PF01938: TRAM" amino acids 389 to 448 (60 residues), 27 bits, see alignment E=4.8e-10

Best Hits

Swiss-Prot: 76% identical to MIAB_SPHAL: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 90% identity to sch:Sphch_1058)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>GFF3937 tRNA-i(6)A37 methylthiotransferase (EC 2.8.4.3) (Sphingobium sp. HT1-2)
MNRNDAPEHKAGKGPATFQVKSFGCQMNVYDGERMAEMLGERGMTAAADGAEADLVILNT
CHIREKAVDKVYSDIGRLTREDGTRPMIAVAGCVAQAEGGEIQRRARNVDIVVGPQAYHR
LPDLIGKAQRGEDAVDTDMPANSKFAALPGRTKQARPTAFLTIMEGCDKFCTYCVVPYTR
GAEISRSWTAILDEARALVDGGVREITLLGQNVNAWTGEDDKGRMQGMDGLARELAKLGG
LERIRYTTSHPNDMSDGLIAAHGDEPKLMPFLHLPVQSGNDRILKAMNRSHTVDSYLRII
ERVREARPDIALSGDFIVGFPGETDAEFEDTLKIVDQVRYAQCYSFKYSPRPGTPAADMD
HQIPAAVMDERLARLQATINRHQVDFNAATVGRTTSILLERKGRYPGQLIGKTPWLQSVH
VTAPEYGIGDMVDVDIISAGPNSLAGEISRRKAA