Protein Info for PS417_20155 in Pseudomonas simiae WCS417

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF01938: TRAM" amino acids 23 to 74 (52 residues), 29 bits, see alignment 3.2e-10 PF05958: tRNA_U5-meth_tr" amino acids 109 to 446 (338 residues), 103.4 bits, see alignment E=5.6e-33 TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA" amino acids 271 to 442 (172 residues), 213.1 bits, see alignment E=3.3e-67 PF01135: PCMT" amino acids 291 to 360 (70 residues), 27 bits, see alignment E=1.4e-09 PF03602: Cons_hypoth95" amino acids 298 to 407 (110 residues), 25.5 bits, see alignment E=3.8e-09 PF05175: MTS" amino acids 298 to 384 (87 residues), 24.3 bits, see alignment E=8.3e-09 PF13847: Methyltransf_31" amino acids 304 to 381 (78 residues), 37.7 bits, see alignment E=7e-13 PF13649: Methyltransf_25" amino acids 308 to 378 (71 residues), 34.2 bits, see alignment E=1.4e-11 PF08241: Methyltransf_11" amino acids 309 to 368 (60 residues), 23.1 bits, see alignment E=3.8e-08

Best Hits

Swiss-Prot: 86% identical to RLMD_PSEPF: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 94% identity to pfs:PFLU4506)

Predicted SEED Role

"tRNA (Uracil54-C5-)-methyltransferase (EC 2.1.1.35)" (EC 2.1.1.35)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.35

Use Curated BLAST to search for 2.1.1.- or 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZX3 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PS417_20155 23S rRNA methyltransferase (Pseudomonas simiae WCS417)
MAKHERGLRFQPTGGSRAPQIPVGKKQRLTIERLANDGRGIVFFEGRTWFVNGALAGEEV
EARVLGTHGKIVEARTERVFSASELRRPAPCAHFGRCGGCSVQHLPHGEQLALKQRMLAE
QLSRVAGVEPQEWAAPLSGAEFGYRRRARVAVRWDARAKQLEVGFRAVASQDIVAIDECP
VLVQALQPIMQRLPNMLRRLSKPQALGHVELFSGTSVAVLLRHIAPLSEADLQVLKEFCA
FHEAQLWLHGEGQPEPVEADSVLGFRLSHWDLELAYRPGDFVQVNAGVNEAMVAQALEWL
APQPDERVLDLFCGLGNFALPLARQVREVVAVEGVQTMVERAAVNAVSNDLHNVQFFQAD
LSQPLTDAEWAKQGFSAVLLDPPRDGALEVVRKLATLGAKRLVYVSCNPATLARDTVELV
KQGYRLKRAGILDMFPQTAHVEAMALFEAG