Protein Info for GFF3935 in Sphingobium sp. HT1-2

Annotation: Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF02130: YbeY" amino acids 22 to 154 (133 residues), 113.8 bits, see alignment E=2.6e-37 TIGR00043: rRNA maturation RNase YbeY" amino acids 45 to 157 (113 residues), 113.8 bits, see alignment E=2.2e-37

Best Hits

Swiss-Prot: 66% identical to YBEY_SPHWW: Endoribonuclease YbeY (ybeY) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 86% identity to sch:Sphch_1060)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>GFF3935 Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly (Sphingobium sp. HT1-2)
MIEVAVLHEEGWPGADWEFLAQQAVSAAIAHSPYAAFATDSTLYEVAVKLTDDDEVHQLN
RAYREKDKPTNVLSFPMVQEDLLEVTANTDDGEVLLGDIVLAEGVCAAEAAEKGISVADH
ATHLIVHGTFHLLGYDHMDDNEAEAMEALEIRALLSLGLADPYGDRDNG