Protein Info for GFF3934 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 16 to 46 (31 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 312 to 336 (25 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 388 to 405 (18 residues), see Phobius details amino acids 408 to 425 (18 residues), see Phobius details amino acids 435 to 446 (12 residues), see Phobius details amino acids 468 to 488 (21 residues), see Phobius details PF01970: TctA" amino acids 17 to 437 (421 residues), 453.4 bits, see alignment E=3.3e-140

Best Hits

KEGG orthology group: None (inferred from 72% identity to met:M446_4286)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>GFF3934 hypothetical protein (Xanthobacter sp. DMC5)
MNAVLAGLDLVLRWDVILTILVASAFGLVVGAMPGLTATMAIALLVPITFFMDPIPAVGA
MISCSAMAIFAGDIPATLMRMPGTPASAAYSDECYAMTRKGEAEVALGANVLFSALGGLF
GTAVLIVSAPLLAEIALGFSSFEYFWLALMGLACAIFIGSGSPVKGLVSLFLGLFVAQIG
IDNPAGVPRFTFGNSNLLGGVDFIPAMIGLFAMSEVIRTIAAGAPDWSVRQTSLGNPLKG
WGRLIVKYWPQQIRGNITGTAIGILPGAGADIAAWVSYAMSRKFSKTPEKFGTGHVEGII
ESTSANNAALAGAWVPALVFGIPGDSITAIVIGVLYLKGLNPGPTLFLNNPESIYAVFII
FIIANLAMIPLGLAALKAGTALLRFPRRILIPLILLFCIVGAYAVNNSAYGVVLMLVFGI
LGFLMEEHDIPIAPCVLGIVLGKMLEESFVTSMIKADGNLLAFFERPIAGGLGVMTLLVF
CLPLWGALKRRRTAAT