Protein Info for GFF3934 in Sphingobium sp. HT1-2

Annotation: Magnesium and cobalt efflux protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00571: CBS" amino acids 89 to 144 (56 residues), 30.7 bits, see alignment E=3.4e-11 amino acids 159 to 208 (50 residues), 24.1 bits, see alignment 3.8e-09 PF03471: CorC_HlyC" amino acids 227 to 304 (78 residues), 58.2 bits, see alignment E=7e-20

Best Hits

KEGG orthology group: None (inferred from 87% identity to sch:Sphch_1061)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF3934 Magnesium and cobalt efflux protein CorC (Sphingobium sp. HT1-2)
MAEGSPKDSAGSKEADSSNEGGLWSGLKSLLFGENEAPSLRKELEEALDEYDEEEQEEGA
APPAKGDLSAIERQMVRNLLHFSEHTVDDVALPRADIVAIEEKASFAELAELFAEAGHSR
IPVYRETLDTIVGMVHIRDAFAILAGKAPVPDTLAPLIRQPLYVPESMGALDLLAEMRAK
RTHLAIVLDEYSGTEGLLTFEDLVEEIVGEVEDEHDDAPEAMLVPLEGGMWDADARAELD
DVAEEIDPRLGEIEEDVDTLGGLAFVLAGRVPEPGEIIPHEQSGWKLEVLVSDGRRVTRL
RLHPPVEQEPEAEEA